PDB entry 7suq

View 7suq on RCSB PDB site
Description: Two-state solution NMR structure of Pin1 bound to peptide FFpSPR
Class: isomerase
Keywords: Prolyl isomerase, WW domain, ISOMERASE
Deposited on 2021-11-17, released 2022-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-08-17, with a file datestamp of 2022-08-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
  Species: Homo sapiens [TaxId:9606]
  Gene: PIN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13526 (0-162)
  Domains in SCOPe 2.08: d7suqa1, d7suqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7suqA (A:)
  madeeklppgwekrmsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvrcshl
  lvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakarg
  dlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte