PDB entry 7rt1

View 7rt1 on RCSB PDB site
Description: Crystal Structure of KRAS G12D with compound 15 (4-(4-[(1R,5S)-3,8-diazabicyclo[3.2.1]octan-3-yl]-8-fluoro-2-{[(2S)-1-methylpyrrolidin-2-yl]methoxy}pyrido[4,3-d]pyrimidin-7-yl)naphthalen-2-ol) bound
Class: hydrolase/inhibitor
Keywords: Oncoprotein, G12D, GTPase, KRAS, Oncology, KRAS4B, MRTX-1133, HYDROLASE-INHIBITOR complex
Deposited on 2021-08-12, released 2021-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-12-22, with a file datestamp of 2021-12-17.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoform 2B of GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116-2 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • conflict (51)
      • conflict (80)
      • conflict (118)
    Domains in SCOPe 2.08: d7rt1a_
  • Heterogens: 7L8, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7rt1A (A:)
gmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

    Sequence, based on observed residues (ATOM records): (download) 
    >7rt1A (A:)
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek