PDB entry 7rsa

View 7rsa on RCSB PDB site
Description: structure of phosphate-free ribonuclease a refined at 1.26 angstroms
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1988-06-10, released 1988-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.15
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00656 (0-123)
  Domains in SCOPe 2.07: d7rsaa_
• Heterogens: TBU, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7rsaA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv