PDB entry 7qcy

View 7qcy on RCSB PDB site
Description: Two-state liquid NMR Structure of a PDZ2 Domain from hPTP1E, complexed with RA-GEF2 peptide
Class: hydrolase
Keywords: Protein-protein recognition domain, HYDROLASE
Deposited on 2021-11-25, released 2022-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-09-07, with a file datestamp of 2022-09-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 13
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN13, PNP1, PTP1E, PTPL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7qcya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7qcyA (A:)
pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
vngvslegathkqavetlrntgqvvhlllekgqspt