PDB entry 7q78

View 7q78 on RCSB PDB site
Description: Room temperature structure of RNase A at 72 MPa helium gas pressure in a sapphire capillary
Class: hydrolase
Keywords: HPMX, high-pressure macromolecular crystallography, sapphire capillary, HYDROLASE
Deposited on 2021-11-09, released 2022-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-11-16, with a file datestamp of 2022-11-11.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7q78a_
  • Heterogens: SO4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7q78A (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv