PDB entry 7pvv

View 7pvv on RCSB PDB site
Description: Crystal structure of the Abl SH3 domain G92N-Y93N-N94T-H95E mutant
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2021-10-05, released 2022-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-09-14, with a file datestamp of 2022-09-09.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcr-abl1 e6a2 chimeric protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCR-ABL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2RQD6 (1-58)
      • expression tag (0)
      • engineered mutation (30-33)
    Domains in SCOPe 2.08: d7pvva_
  • Heterogens: PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7pvvA (A:)
    gpnlfvalydfvasgdntlsitkgeklrvlnntengewceaqtkngqgwvpsnyitpvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >7pvvA (A:)
    nlfvalydfvasgdntlsitkgeklrvlnntengewceaqtkngqgwvpsnyitpvn