PDB entry 7pti

View 7pti on RCSB PDB site
Description: structural effects induced by removal of a disulfide bridge. the x-ray structure of the c30a(slash)c51a mutant of basic pancreatic trypsin inhibitor at 1.6 angstroms
Deposited on 1990-03-08, released 1991-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d7pti__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7pti_ (-)
    rpdfcleppytgpckariiryfynakaglaqtfvyggcrakrnnfksaedamrtcgga