PDB entry 7pcy

View 7pcy on RCSB PDB site
Description: the crystal structure of plastocyanin from a green alga, enteromorpha prolifera
Class: electron transport protein
Keywords: electron transport protein
Deposited on 1989-09-22, released 1990-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.117
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Enteromorpha prolifera
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07465 (0-97)
  Domains in SCOP 1.75: d7pcya_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7pcyA (A:)
  aaivklggddgslafvpnnitvgagesiefinnagfphnivfdedavpagvdadaisaed
  ylnskgqtvvrklttpgtygvycdphsgagmkmtitvq