PDB entry 7pcy

View 7pcy on RCSB PDB site
Description: the crystal structure of plastocyanin from a green alga, enteromorpha prolifera
Deposited on 1989-09-22, released 1990-07-15
The last revision prior to the SCOP 1.61 freeze date was dated 1990-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.117
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d7pcy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7pcy_ (-)
  aaivklggddgslafvpnnitvgagesiefinnagfphnivfdedavpagvdadaisaed
  ylnskgqtvvrklttpgtygvycdphsgagmkmtitvq