PDB entry 7paz

View 7paz on RCSB PDB site
Description: reduced mutant p80i pseudoazurin from a. faecalis
Deposited on 1997-02-21, released 1997-08-20
The last revision prior to the SCOP 1.61 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d7paz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7paz_ (-)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctihyamgmialiavgdspanldqivsakkpkivqerlekvia
sak