PDB entry 7oft

View 7oft on RCSB PDB site
Description: Structure of SARS-CoV-2 Papain-like protease PLpro in complex with p-hydroxybenzaldehyde
Class: hydrolase
Keywords: Papain-like protease SARS-CoV-2 Hydrolase Zinc binding protein, HYDROLASE
Deposited on 2021-05-05, released 2021-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural protein 3
    Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7ofta1, d7ofta2
  • Heterogens: HBA, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7oftA (A:)
evrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpn
ddtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnncylatalltl
qqielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanlds
ckrvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqesp
fvmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpi
tdvfykensytttik