PDB entry 7o9u

View 7o9u on RCSB PDB site
Description: solution structure of oxidized cytochrome c552 from thioalkalivibrio paradoxus
Deposited on 2021-04-17, released 2021-05-05
The last revision was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c552
    Species: Thioalkalivibrio paradoxus ARh 1 [TaxId:713585]
    Gene: WP_006748979.1
    Database cross-references and differences (RAF-indexed):
    • PDB 7O9U (0-152)
  • Heterogens: HEC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7o9uA (A:)
mdiginsdphpphhhdhhghgsgwevpeaeihrenpippdarsldqggvlyaehcvrchg
etlrgdgpdahdldppvadlvehaphhsdgdlayrvrigrgpmpgfgdalderdiwdlvn
fmrdraqgaalagtnghspdhaagdhhhgdhhh