PDB entry 7o5k

View 7o5k on RCSB PDB site
Description: Structure of thaumatin determined at SwissFEL using native-SAD at 6.02 keV with photon energy bandwidth of 2.15% and pinkIndexer with 30000 indexed images
Class: plant protein
Keywords: native-SAD, large bandwidth, pink beam, SFX, serial crystallography, pinkIndexer, PLANT PROTEIN
Deposited on 2021-04-08, released 2022-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-04-20, with a file datestamp of 2022-04-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thaumatin-1
  Species: Thaumatococcus daniellii [TaxId:4621]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02883 (0-206)
  Domains in SCOPe 2.08: d7o5ka_
• Heterogens: TLA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7o5kA (A:)
  atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
  sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
  crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
  fsyvldkpttvtcpgssnyrvtfcpta