PDB entry 7o5h

View 7o5h on RCSB PDB site
Description: Ribosomal methyltransferase KsgA bound to small ribosomal subunit
Class: ribosome
Keywords: Methyltransferase KsgA, 30S, RIBOSOME
Deposited on 2021-04-08, released 2021-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16s rRNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'B':
  Compound: 30S ribosomal protein S2
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3K3SDJ5 (0-224)
• Chain 'D':
  Compound: 30S ribosomal protein S4
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot V0YKB3 (0-204)
• Chain 'E':
  Compound: 30S ribosomal protein S5
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1AGJ2 (0-157)
• Chain 'F':
  Compound: 30S ribosomal protein S6, fully modified isoform
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02358 (0-End)
• Chain 'H':
  Compound: 30S ribosomal protein S8
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot H4JDM0 (0-128)
• Chain 'K':
  Compound: 30S ribosomal protein S11
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A5I5F5V9 (0-116)
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot I2UHF1 (0-122)
• Chain 'O':
  Compound: 30S ribosomal protein S15
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E9YUR8 (0-End)
• Chain 'P':
  Compound: 30S ribosomal protein S16
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot C3SYP2 (0-81)
• Chain 'Q':
  Compound: 30S ribosomal protein S17
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot T6LV72 (0-End)
• Chain 'R':
  Compound: 30S ribosomal protein S18
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A7ZV73 (0-54)
• Chain 'T':
  Compound: 30S ribosomal protein S20
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot I4T5W9 (0-85)
• Chain 'U':
  Compound: 30S ribosomal protein S21
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A5C9AJ78 (Start-55)
• Chain 'V':
  Compound: Ribosomal RNA small subunit methyltransferase A
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: rsmA, ksgA, FAZ83_07175
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A4S5B3V1 (Start-251)
  Domains in SCOPe 2.08: d7o5hv_
• Heterogens: MG

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  Sequence, based on SEQRES records: (download)
  

  >7o5hV (V:)
  qnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlq
  thpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadm
  hfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvp
  hatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaq
  ycqmanylaena
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7o5hV (V:)
  nflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlqt
  hpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadmh
  fmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvph
  atmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaqy
  cqmanylaena