PDB entry 7nvm

View 7nvm on RCSB PDB site
Description: Human TRiC complex in closed state with nanobody Nb18, actin and PhLP2A bound
Class: chaperone
Keywords: TRiC, CCT, ATP hydrolysis, type II chaperonin, protein folding, actin, Structural Genomics, Structural Genomics Consortium, SGC, CHAPERONE
Deposited on 2021-03-15, released 2022-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-05-04, with a file datestamp of 2022-04-29.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: T-complex protein 1 subunit alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17987 (0-555)
• Chain 'B':
  Compound: T-complex protein 1 subunit beta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78371 (0-534)
• Chain 'D':
  Compound: T-complex protein 1 subunit delta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50991 (0-538)
• Chain 'E':
  Compound: T-complex protein 1 subunit epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CCT5, CCTE, KIAA0098
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48643 (0-540)
• Chain 'G':
  Compound: t-complex protein 1 subunit gamma
  Species: Homo sapiens [TaxId:9606]
  Gene: CCT3, CCTG, TRIC5
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49368 (0-544)
• Chain 'H':
  Compound: T-complex protein 1 subunit eta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99832 (0-542)
• Chain 'K':
  Compound: Actin, cytoplasmic 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63261 (0-374)
  Domains in SCOPe 2.08: d7nvmk1, d7nvmk2
• Chain 'N':
  Compound: nanobody nb18
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 7NVM (0-128)
• Chain 'P':
  Compound: Phosducin-like protein 3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H2J4 (0-238)
• Chain 'Q':
  Compound: T-complex protein 1 subunit theta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50990 (0-547)
• Chain 'Z':
  Compound: T-complex protein 1 subunit zeta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40227 (0-530)
• Chain 'a':
  Compound: T-complex protein 1 subunit alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17987 (0-555)
• Chain 'b':
  Compound: T-complex protein 1 subunit beta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78371 (0-534)
• Chain 'd':
  Compound: T-complex protein 1 subunit delta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50991 (0-538)
• Chain 'e':
  Compound: T-complex protein 1 subunit epsilon
  Species: Homo sapiens [TaxId:9606]
  Gene: CCT5, CCTE, KIAA0098
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48643 (0-540)
• Chain 'g':
  Compound: t-complex protein 1 subunit gamma
  Species: Homo sapiens [TaxId:9606]
  Gene: CCT3, CCTG, TRIC5
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49368 (0-544)
• Chain 'h':
  Compound: T-complex protein 1 subunit eta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99832 (0-542)
• Chain 'n':
  Compound: nanobody nb18
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 7NVM (0-128)
  Domains in SCOPe 2.08: d7nvmn1, d7nvmn2
• Chain 'q':
  Compound: T-complex protein 1 subunit theta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50990 (0-547)
• Chain 'z':
  Compound: T-complex protein 1 subunit zeta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40227 (0-530)
• Heterogens: ADP, MG, AF3, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'K':
  Sequence, based on SEQRES records: (download)
  

  >7nvmK (K:)
  meeeiaalvidngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
  krgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmt
  qimfetfntpamyvaiqavlslyasgrttgivmdsgdgvthtvpiyegyalphailrldl
  agrdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksy
  elpdgqvitignerfrcpealfqpsflgmescgihettfnsimkcdvdirkdlyantvls
  ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskq
  eydesgpsivhrkcf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7nvmK (K:)
  aalvidngsgmckagfagddapravfpsikdsyvgdeaqskrgiltlkypiehgivtnwd
  dmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyvaiqavl
  slyasgrttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkitttaerei
  vrdikeklcyvaldfeqematalfqpsflgmescgihettfnsimkcdvdirkdlyantv
  lsggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwis
  kqeydesgpsivhrkcf
  

  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'Z':
  No sequence available.
  
  
• Chain 'a':
  No sequence available.
  
  
• Chain 'b':
  No sequence available.
  
  
• Chain 'd':
  No sequence available.
  
  
• Chain 'e':
  No sequence available.
  
  
• Chain 'g':
  No sequence available.
  
  
• Chain 'h':
  No sequence available.
  
  
• Chain 'n':
  Sequence, based on SEQRES records: (download)
  

  >7nvmn (n:)
  qvqlvesggglvqaggslrlscgasgtffrindmgwyrqasgkqrelvasitrggttdya
  dsvkgrftisrdnakntvylqmnslkpedtavyyckanrnwgrewddywgqgtqvtvssh
  hhhhhepea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7nvmn (n:)
  qvqlvesggglvqaggslrlscgasgtffrindmgwyrqasgkqrelvasitrggttdya
  dsvkgrftisrdnakntvylqmnslkpedtavyyckanrnwgrewddywgqgtqvtvss
  

  
  
• Chain 'q':
  No sequence available.
  
  
• Chain 'z':
  No sequence available.