PDB entry 7nq6

View 7nq6 on RCSB PDB site
Description: high resolution crystal structure of c-terminal domain (residues 715- 866) of nucleoporin-98
Deposited on 2021-03-01, released 2021-04-07
The last revision was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear pore complex protein Nup96
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: NUP98
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6ZMG3 (1-151)
      • expression tag (0)
  • Heterogens: CL, MPD, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7nq6A (A:)
shpagiiltrdsyytipsmeelarsvdengecivngftigregfgsiyfegivnltnldl
dsivhirrkevivyvddqnkpplgeglnrpaqvtldevwpidktsrcmitsperlsemny
ksklenasrkqgaqfvdyrpesgswvfkvnhf