PDB entry 7no0

View 7no0 on RCSB PDB site
Description: Structure of the mature RSV CA lattice: T=1 CA icosahedron
Class: viral protein
Keywords: Retrovirus, Rous sarcoma virus, capsid protein, IP6, VIRAL PROTEIN
Deposited on 2021-02-25, released 2021-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein p27, alternate cleaved 1
    Species: Rous sarcoma virus (strain Prague C) [TaxId:11888]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7no0a1, d7no0a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7no0A (A:)
pvviktegpawtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvi
lgpapyalwmdawgvqlqtviaaatrdprhpangqgrgertnlnrlkgladgmvgnpqgq
aallrpgelvaitasalqafrevarlaepagpwadimqgpsesfvdfanrlikavegsdl
ppsarapviidcfrqksqpdiqqlirtapstlttpgeiikyvldrqkta