PDB entry 7njh

View 7njh on RCSB PDB site
Description: HEX1 (in cellulo) grown inside HARE serial crystallography chip
Class: structural protein
Keywords: serial crystallography, HEX1, in-cellulo, silicon chip, STRUCTURAL PROTEIN
Deposited on 2021-02-16, released 2021-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Woronin body major protein
    Species: NEUROSPORA CRASSA (STRAIN ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) [TaxId:367110]
    Gene: hex-1, NCU08332
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7njha1, d7njha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7njhA (A:)
    mgyydddahghveadaaprattgtgtgsasqtvtipchhirlgdililqgrpcqvirist
    saatgqhrylgvdlftkqlheessfvsnpapsvvvqtmlgpvfkqyrvldmqdgsivamt
    etgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgremavdmkvvhgsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7njhA (A:)
    gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv
    snpapsvvvqtmlgpvfkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafe
    sgrgsvrvlvvsdhgremavdmkvvhg