PDB entry 7nip

View 7nip on RCSB PDB site
Description: titin n2a unique sequence (un2a) core
Deposited on 2021-02-13, released 2021-03-03
The last revision was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoform 11 of Titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7nipA (A:)
mdimellknvdpkeyekyarmygitdfrgllqafellkqsq

    Sequence, based on observed residues (ATOM records):
    >7nipA (A:)
dimellknvdpkeyekyarmygitdfrgllqafellkqsq