PDB entry 7net

View 7net on RCSB PDB site
Description: Crystal structure of the v-Src SH3 domain W95R-I96T mutant
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2021-02-04, released 2021-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v-Src SH3 domain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 7NET
    Domains in SCOPe 2.08: d7neta_
  • Chain 'B':
    Compound: v-Src SH3 domain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 7NET
    Domains in SCOPe 2.08: d7netb_
  • Heterogens: PEG, PGE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7netA (A:)
ggvttfvalydyesrtetdlsfkkgerlqivnntegnwwlahsvttgqtgyipsnyvaps
d

    Sequence, based on observed residues (ATOM records): (download) 
    >7netA (A:)
ttfvalydyesrtetdlsfkkgerlqivnntegnwwlahsvttgqtgyipsnyvaps

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7netB (B:)
ggvttfvalydyesrtetdlsfkkgerlqivnntegnwwlahsvttgqtgyipsnyvaps
d

    Sequence, based on observed residues (ATOM records): (download) 
    >7netB (B:)
ttfvalydyesrtetdlsfkkgerlqivnntegnwwlahsvttgqtgyipsnyvaps