PDB entry 7nen

View 7nen on RCSB PDB site
Description: Crystal structure of outer surface protein C (OspC) from Borrelia garinii
Class: unknown function
Keywords: Lyme disease, tick-borne disease, OspC, Borrelia garinii, UNKNOWN FUNCTION
Deposited on 2021-02-04, released 2021-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer surface protein c
    Species: Borrelia garinii [TaxId:29519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7nena_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7nenA (A:)
    kgpdltviskkitdsnavvlavkeveallssidelakaigqkidrnnglaveanfntsll
    agaytistlitkkldeliknsgelkgevekakncseaftnklkektqelavaagaatdid
    akkailktnrdkdlgadelgklfksveslskaaqeasansvkeltspvvaenpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >7nenA (A:)
    ltviskkitdsnavvlavkeveallssidelakaigqkidrnnglaveanfntsllagay
    tistlitkkldeliknsgelkgevekakncseaftnklkektqelavaagaatdidakka
    ilktnrdkdlgadelgklfksveslskaaqeasansvkel