PDB entry 7ndw

View 7ndw on RCSB PDB site
Description: ThyX-FADH2 soaked with 20 mM Formaldehyde
Class: transferase
Keywords: flavin-dependent thymidylate synthase, methylenetetrahydrofolate, transferase
Deposited on 2021-02-02, released 2021-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Flavin-dependent thymidylate synthase
  Species: Thermotoga maritima [TaxId:2336]
  Gene: thyX, thy1, TM_0449
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WYT0 (12-231)
    • initiating methionine (0)
    • expression tag (1-11)
• Chain 'B':
  Compound: Flavin-dependent thymidylate synthase
  Species: Thermotoga maritima [TaxId:2336]
  Gene: thyX, thy1, TM_0449
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WYT0 (12-231)
    • initiating methionine (0)
    • expression tag (1-11)
• Chain 'C':
  Compound: Flavin-dependent thymidylate synthase
  Species: Thermotoga maritima [TaxId:2336]
  Gene: thyX, thy1, TM_0449
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WYT0 (12-231)
    • initiating methionine (0)
    • expression tag (1-11)
• Chain 'D':
  Compound: Flavin-dependent thymidylate synthase
  Species: Thermotoga maritima [TaxId:2336]
  Gene: thyX, thy1, TM_0449
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WYT0 (12-231)
    • initiating methionine (0)
    • expression tag (1-11)
  Domains in SCOPe 2.08: d7ndwd1, d7ndwd2
• Heterogens: FDA, HUF, PEG, PO4, PG4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >7ndwD (D:)
  mgsdkihhhhhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieyl
  mkhghetpfehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperleg
  ykttippervtekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslm
  nflnlradshaqweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7ndwD (D:)
  hhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfe
  hivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttipperv
  tekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsh
  aqweiqqyalaiarifkekcpwtfeaflkyaykgdilk