PDB entry 7myy

View 7myy on RCSB PDB site
Description: Crystal Structure of HIV-1 PRS17 with GRL-142
Class: HYDROLASE/Inhibitor
Keywords: HIV-1 Protease, Multi drug resistant, Hydrolase inhibitor complex, HYDROLASE, HYDROLASE-Inhibitor complex
Deposited on 2021-05-22, released 2021-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot I7AJ09 (0-98)
    • conflict (6)
    • conflict (45)
    • conflict (47)
    • conflict (66)
    • conflict (76)
    • conflict (81)
    • conflict (92)
    • conflict (94)
  Domains in SCOPe 2.08: d7myya_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot I7AJ09 (0-98)
    • conflict (6)
    • conflict (45)
    • conflict (47)
    • conflict (66)
    • conflict (76)
    • conflict (81)
    • conflict (92)
    • conflict (94)
  Domains in SCOPe 2.08: d7myyb_
• Heterogens: 7OA, GOL, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7myyA (A:)
  pqitlwkrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
  qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7myyB (B:)
  pqitlwkrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
  qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf