PDB entry 7mwl

View 7mwl on RCSB PDB site
Description: the tam domain of baz2a in complex with a 12mer mcg dna
Deposited on 2021-05-17, released 2021-07-21
The last revision was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF9 (1-118)
      • expression tag (0)
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF9 (1-118)
      • expression tag (0)
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(5cm)p*gp*tp*tp*gp*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(5cm)p*gp*tp*tp*gp*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7mwlA (A:)
gsgsgdvmrrriatpeevrlplqhgwrrevrikkgshrwqgetwyygpcgkrmkqfpevi
kylsrnvvhsvrrehfsfsprmpvgdffeerdtpeglqwvqlsaeeipsriqaitgkrg

    Sequence, based on observed residues (ATOM records):
    >7mwlA (A:)
rrriatpeevrlplqhgwrrevrikkgshrwqgetwyygpcgkrmkqfpevikylsrnvv
hsvrrehfsfsprmpvgdffeerdtpeglqwvqlsaeeipsriqaitg

  • Chain 'B':
    Sequence, based on SEQRES records:
    >7mwlB (B:)
gsgsgdvmrrriatpeevrlplqhgwrrevrikkgshrwqgetwyygpcgkrmkqfpevi
kylsrnvvhsvrrehfsfsprmpvgdffeerdtpeglqwvqlsaeeipsriqaitgkrg

    Sequence, based on observed residues (ATOM records):
    >7mwlB (B:)
iatpeevrlplqhgwrrevrikkgshrwqgetwyygpcgkrmkqfpevikylsrnvvhsv
rrehfsfsprmpvgdffeerdtpeglqwvqlsaeeipsriqaitg

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.