PDB entry 7mwk

View 7mwk on RCSB PDB site
Description: crystal structure of mbd2 with dna
Deposited on 2021-05-17, released 2021-07-07
The last revision was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methyl-CpG-binding domain protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: MBD2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBB5 (1-78)
    • expression tag (0)
    • conflict (46)
• Chain 'B':
  Compound: Methyl-CpG-binding domain protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: MBD2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBB5 (1-78)
    • expression tag (0)
    • conflict (46)
• Chain 'C':
  Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(mc)p*gp*tp*tp*gp*gp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'D':
  Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(mc)p*gp*tp*tp*gp*gp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(mc)p*gp*tp*tp*gp*gp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'F':
  Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(mc)p*gp*tp*tp*gp*gp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence, based on SEQRES records:
  

  >7mwkA (A:)
  gatesgkrmdcpalppgwkkeevirksglsagksdvyyfspsgkkfkskpqlarylgntv
  dlssfdfrtgkmmpsklqk
  

  
  Sequence, based on observed residues (ATOM records):
  

  >7mwkA (A:)
  krmdcpalppgwkkeevirksglsagksdvyyfspsgkkfkskpqlarylgntvdlssfd
  frtgkmmp
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >7mwkB (B:)
  gatesgkrmdcpalppgwkkeevirksglsagksdvyyfspsgkkfkskpqlarylgntv
  dlssfdfrtgkmmpsklqk
  

  
  Sequence, based on observed residues (ATOM records):
  

  >7mwkB (B:)
  krmdcpalppgwkkeevirksglsagksdvyyfspsgkkfkskpqlarylgntvdlssfd
  frtgkmmp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.