PDB entry 7mt1

View 7mt1 on RCSB PDB site
Description: Crystal structure of Human Platelet-activating factor acetylhydrolase IB subunit beta (PAFAH1B1)
Class: protein binding
Keywords: PAFAH1B1, WD40, WD-repeat protein, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING
Deposited on 2021-05-12, released 2021-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet-activating factor acetylhydrolase IB subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PAFAH1B1, LIS1, MDCR, MDS, PAFAHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7mt1a_
  • Heterogens: GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7mt1A (A:)
    mhhhhhhssgrenlyfqggqkrdpkewiprppekyalsghrspvtrvifhpvfsvmvsas
    edatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfqgfecirt
    mhghdhnvssvaimpngdhivsasrdktikmwevqtgycvktftghrewvrmvrpnqdgt
    liascsndqtvrvwvvatkeckaelrehehvveciswapessyssiseatgsetkksgkp
    gpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddktlrvwdy
    knkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >7mt1A (A:)
    dpkewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkgh
    tdsvqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvaimpngdhivs
    asrdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeck
    aelrehehvveciswapessyssiseatgkpgpfllsgsrdktikmwdvstgmclmtlvg
    hdnwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvv
    tgsvdqtvkvwecr