PDB entry 7ms6

View 7ms6 on RCSB PDB site
Description: Structure of USP5 zinc-finger ubiquitin binding domain co-crystallized with (2-fluoro-4-((4-phenylpiperidin-1-yl)sulfonyl)benzoyl)glycine
Class: hydrolase/inhibitor
Keywords: USP5, ubiquitin, USP, ubiquitin specific protease, HYDROLASE, HYDROLASE-INHIBITOR complex
Deposited on 2021-05-10, released 2021-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin carboxyl-terminal hydrolase 5
  Species: Homo sapiens [TaxId:9606]
  Gene: USP5, ISOT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45974
  Domains in SCOPe 2.08: d7ms6a_
• Heterogens: ZPV, SO4, EDO, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7ms6A (A:)
  ggevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsgg
  nnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt
  d
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7ms6A (A:)
  vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
  avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidm