PDB entry 7m40

View 7m40 on RCSB PDB site
Description: Discovery of small molecule antagonists of human Retinoblastoma Binding Protein 4 (RBBP4)
Class: gene regulation
Keywords: RBBP4, Structural Genomics, Structural Genomics Consortium, SGC, GENE REGULATION
Deposited on 2021-03-19, released 2021-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7m40a_
  • Chain 'B':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7m40b_
  • Heterogens: YQJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7m40A (A:)
    mhhhhhhssgrenlyfqgmadkeaafddaveervineeykiwkkntpflydlvmthalew
    psltaqwlpdvtrpegkdfsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsek
    gefggfgsvsgkieieikinhegevnrarympqnpciiatktpssdvlvfdytkhpskpd
    psgecnpdlrlrghqkegyglswnpnlsghllsasddhticlwdisavpkegkvvdakti
    ftghtavvedvswhllheslfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfn
    pysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrl
    nvwdlskigeeqspedaedgppellfihgghtakisdfswnpnepwvicsvsednimqvw
    qmaeniyndedpegsvdpegqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >7m40A (A:)
    fddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlv
    lgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieikinhegev
    nrarympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnp
    nlsghllsasddhticlwdisavpkgkvvdaktiftghtavvedvswhllheslfgsvad
    dqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlkl
    klhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspdaedgppellfi
    hgghtakisdfswnpnepwvicsvsednimqvwqmaeniyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7m40B (B:)
    mhhhhhhssgrenlyfqgmadkeaafddaveervineeykiwkkntpflydlvmthalew
    psltaqwlpdvtrpegkdfsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsek
    gefggfgsvsgkieieikinhegevnrarympqnpciiatktpssdvlvfdytkhpskpd
    psgecnpdlrlrghqkegyglswnpnlsghllsasddhticlwdisavpkegkvvdakti
    ftghtavvedvswhllheslfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfn
    pysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrl
    nvwdlskigeeqspedaedgppellfihgghtakisdfswnpnepwvicsvsednimqvw
    qmaeniyndedpegsvdpegqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >7m40B (B:)
    aafddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihr
    lvlgthtsdeqnhlviasvqlpngkieieikinhegevnrarympqnpciiatktpssdv
    lvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhticlwdisa
    vpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnntskpshsv
    dahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphn
    etilassgtdrrlnvwdlskigeeqsdaedgppellfihgghtakisdfswnpnepwvic
    svsednimqvwqmaeniyn