PDB entry 7m3n

View 7m3n on RCSB PDB site
Description: Canine parvovirus and Fab14 asymmetric reconstruction
Class: VIRUS/Immune System
Keywords: canine parvovirus, CPV, Fab14, VIRUS, VIRUS-Immune System complex
Deposited on 2021-03-18, released 2021-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: EM
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein 2
    Species: Canine parvovirus type 2 [TaxId:10788]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: CPV Fab14 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 7M3N (0-118)
    Domains in SCOPe 2.08: d7m3nh_
  • Chain 'L':
    Compound: CPV Fab14 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 7M3N (0-107)
    Domains in SCOPe 2.08: d7m3nl_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7m3nH (H:)
avhlqgtelvkpgasagvklsckasgytftnydmnwvrqrpeqglewigwifpgdgstry
nekfkgkatlttdkssstayqlnrltsedsavyfcarrgshgsysfaywgqgtlvtvsg

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7m3nL (L:)
divmtqshkfmstsvgdrvsitckasqdvntalawyqqipgqspklliysasnrytgvpd
rftasgsgtdftftissvqaedlalyycqqhyttpwtfgggtkleikr