PDB entry 7ly0

View 7ly0 on RCSB PDB site
Description: SARS-CoV-2 S/S2M11/S2M28 Local Refinement
Class: viral protein/immune system
Keywords: Antibody, VIRAL PROTEIN, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2021-03-05, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: EM
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spike glycoprotein
    Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
    Gene: S, 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: S2M28 Fab Heavy Chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7LY0 (0-116)
    Domains in SCOPe 2.08: d7ly0h_
  • Chain 'L':
    Compound: S2M28 Fab Light Chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7LY0 (0-105)
    Domains in SCOPe 2.08: d7ly0l_
  • Heterogens: FUC, NAG, MAN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7ly0H (H:)
vqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvtviwydgsnryya
dsvkgrftisrdnskntlylqmdslraedtavyycaravagewyfdywgqgtlvtvs

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7ly0L (L:)
yeltqppsvsvspgqtaritcsgdalakhyaywyrqkpgqapvlviykdserpsgiperf
sgsssgttvtltisgvqaedeadyycqsadsigsswvfgggtkltv