PDB entry 7lwf

View 7lwf on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain in complex with OICR-9320
Class: transcription/inhibitor
Keywords: immunity, inflammatory response, transcription repressor, TRANSCRIPTION-INHIBITOR complex
Deposited on 2021-03-01, released 2022-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-03-09, with a file datestamp of 2022-03-04.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (0-124)
      • engineered mutation (3)
      • engineered mutation (62)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d7lwfa_
  • Heterogens: YNA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7lwfA (A:)
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikase

    Sequence, based on observed residues (ATOM records): (download) 
    >7lwfA (A:)
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as