PDB entry 7lvs

View 7lvs on RCSB PDB site
Description: The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
Class: transcription
Keywords: Complex, Intrinsically Disordered Protein, TRANSCRIPTION
Deposited on 2021-02-26, released 2021-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Histone lysine acetyltransferase CREBBP
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7lvsb_
  • Chain 'F':
    Compound: Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1A, BHLHE78, MOP1, PASD8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99967 (5-35)
      • expression tag (0-4)
    • Uniprot Q16665 (36-66)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7lvsB (B:)
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
gkacqvahcassrqiishwknctrhdcpvclplknasdkr

    Sequence, based on observed residues (ATOM records): (download) 
    >7lvsB (B:)
tgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqag
kacqvahcassrqiishwknctrhdcpvclplknasd

  • Chain 'F':
    No sequence available.