PDB entry 7lp1

View 7lp1 on RCSB PDB site
Description: Structure of Nedd4L WW3 domain
Class: ligase
Keywords: PPxY binding, E3 Ubiquitin ligase, Nedd4L, LIGASE
Deposited on 2021-02-11, released 2021-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase NEDD4-like
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4L, KIAA0439, NEDL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7lp1a_
  • Heterogens: NO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7lp1A (A:)
vtqsflppgwemriapngrpffidhntktttwedprlkf