PDB entry 7lj6

View 7lj6 on RCSB PDB site
Description: crystal structure of mtcnnm cbs-pair domain in complex with mg2+-atp
Deposited on 2021-01-28, released 2021-02-24
Made obsolete by 7msu on 2021-06-16

The last revision was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolysin, contains CBS domains
    Species: Methanoculleus thermophilus [TaxId:2200]
    Gene: SAMN04488571_101329
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7lj6A (A:)
    dttarevmtprvdvvmiedtatlesalaifnetgfsripvyheridnivgllnvkdvfsa
    vfrqqtsatirdlmyepyfipeskkidellkelqvkkqhmavvldeygsfagivtvedml
    eelvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >7lj6A (A:)
    dttarevmtprvdvvmiedtatlesalaifnetgfsripvyheridnivgllnvkdvfsa
    vqqtsatirdlmyepyfipeskkidellkelqvkkqhmavvldeygsfagivtvedmlee
    lv