PDB entry 7liy

View 7liy on RCSB PDB site
Description: CaRSP2 and scaffolded phycoerythrin beta subunits from the phycobilisome of Porphyridium purpureum
Class: photosynthesis
Keywords: linker, phycobilisome, PBS, light harvesting, red algae, scaffolding, PHOTOSYNTHESIS
Deposited on 2021-01-28, released 2021-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CaRSP2
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: B-phycoerythrin beta chain
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7liyb_
  • Chain 'C':
    Compound: B-phycoerythrin beta chain
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7liyc_
  • Heterogens: PEB

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7liyB (B:)
mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7liyC (C:)
mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais