PDB entry 7liq

View 7liq on RCSB PDB site
Description: X-ray structure of SPOP MATH domain (S119A)
Class: protein binding
Keywords: SPOP, 53BP1, DNA damage response, Homologous recombination, Ubiquitin ligase, PROTEIN BINDING
Deposited on 2021-01-27, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Speckle-type POZ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SPOP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43791 (5-142)
      • expression tag (0-4)
      • engineered mutation (95)
    Domains in SCOPe 2.08: d7liqa1, d7liqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7liqA (A:)
gpghmvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdy
lslylllvscpksevrakfkfsilnakgeetkameaqrayrfvqgkdwgfkkfirrdfll
deangllpddkltlfcevsvvqd