PDB entry 7lhx

View 7lhx on RCSB PDB site
Description: Human U1A protein with F37M and F77M mutations for improved phasing
Class: RNA binding protein
Keywords: RNA-ligand interactions, RNA recognition motif, RNA binding domain, RNA binding protein
Deposited on 2021-01-26, released 2021-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-97)
      • engineered mutation (30)
      • engineered mutation (35-36)
      • engineered mutation (76)
    Domains in SCOPe 2.07: d7lhxa_
  • Heterogens: NA, ACT, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7lhxA (A:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrmgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpmydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records): (download) 
    >7lhxA (A:)
vpetrpnhtiyinnlnekikkdelkkslhaifsrmgqildilvsrslkmrgqafvifkev
ssatnalrsmqgfpmydkpmriqyaktdsdiiakmk