PDB entry 7lho

View 7lho on RCSB PDB site
Description: Crystal structure of Q108K:K40L:T51V:T53C:R58W:T29L:Y19W:Q4A mutant of cellular retinol binding protein II complex with all-trans-retinal in the dark
Class: transport protein
Keywords: hCRBPII, Q4A, isomerization, retinal, cis, trans, rhodopsin, bacteriorhodopsin, CYTOSOLIC PROTEIN, TRANSPORT PROTEIN
Deposited on 2021-01-26, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (3)
      • engineered mutation (18)
      • engineered mutation (28)
      • engineered mutation (39)
      • engineered mutation (50)
      • engineered mutation (52)
      • engineered mutation (57)
      • engineered mutation (107)
    Domains in SCOPe 2.08: d7lhoa_
  • Chain 'B':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (3)
      • engineered mutation (18)
      • engineered mutation (28)
      • engineered mutation (39)
      • engineered mutation (50)
      • engineered mutation (52)
      • engineered mutation (57)
      • engineered mutation (107)
    Domains in SCOPe 2.08: d7lhob_
  • Heterogens: RET, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7lhoA (A:)
trdangtwemesnenfegwmkaldidfalrkiavrltqtlvidqdgdnfkvkctstfwny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7lhoB (B:)
trdangtwemesnenfegwmkaldidfalrkiavrltqtlvidqdgdnfkvkctstfwny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk