PDB entry 7lei

View 7lei on RCSB PDB site
Description: HIV-1 Protease WT (NL4-3) in Complex with PU10 (LR4-07)
Class: hydrolase/hydrolase inhibitor
Keywords: hiv, nl4-3 protease, protease inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2021-01-14, released 2022-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-01-26, with a file datestamp of 2022-01-21.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8ULI9 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.08: d7leia_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8ULI9 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.08: d7leib_
• Heterogens: XVV, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7leiA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7leiB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf