PDB entry 7l64

View 7l64 on RCSB PDB site
Description: C-type carbohydrate-recognition domain 4 of the mannose receptor complexed with Lewis-a
Class: sugar binding protein
Keywords: glycobiology, carbohydrate-binding protein, c-type lectin, complex, sugar binding protein
Deposited on 2020-12-23, released 2021-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage mannose receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MRC1, CLEC13D, CLEC13DL, MRC1L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22897 (1-134)
      • expression tag (0)
    Domains in SCOPe 2.08: d7l64a_
  • Heterogens: CA, FUC, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7l64A (A:)
    acpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlit
    asgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmsw
    ndincehlnnwicqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >7l64A (A:)
    lcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasgsyhklfwlgl
    tygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndincehlnnwic
    qi