PDB entry 7l0m

View 7l0m on RCSB PDB site
Description: Vanadate-bound YopH G352T
Class: hydrolase
Keywords: Protein Tyrosine Phosphatase, HYDROLASE
Deposited on 2020-12-11, released 2021-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-tyrosine-phosphatase
    Species: Yersinia pestis [TaxId:632]
    Gene: yopH, Y0013, YPCD1.67c, G4D65_20050, G4D67_19670, GD372_22270
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68720 (Start-305)
      • conflict (72)
      • engineered mutation (189)
      • conflict (229)
    Domains in SCOPe 2.07: d7l0ma_
  • Heterogens: VO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7l0mA (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvtnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >7l0mA (A:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvtnwpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns