PDB entry 7l0j

View 7l0j on RCSB PDB site
Description: Structure of AMH bound to AMHR2-ECD
Class: signaling protein
Keywords: Transforming Growth Factor Beta, Complex, Mullerian Duct Regression, SIGNALING PROTEIN
Deposited on 2020-12-11, released 2021-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muellerian-inhibiting factor
    Species: Homo sapiens [TaxId:9606]
    Gene: AMH, MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03971 (7-108)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d7l0ja_
  • Chain 'B':
    Compound: Anti-Muellerian hormone type-2 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AMHR2, AMHR, MISR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16671 (4-110)
      • expression tag (2-3)
  • Heterogens: NAG, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7l0jA (A:)
sagataadgpcalrelsvdlraersvlipetyqanncqgvcgwpqsdrnprygnhvvlll
kmqargaalarppccvptayagkllislseerisahhvpnmvatecgcr

    Sequence, based on observed residues (ATOM records): (download) 
    >7l0jA (A:)
dgpcalrelsvdlraersvlipetyqanncqgvcgwpqsdrnprygnhvvlllkmqarga
alarppccvptayagkllislseerisahhvpnmvatecgcr

  • Chain 'B':
    No sequence available.