PDB entry 7l09

View 7l09 on RCSB PDB site
Description: Cryo-EM structure of SARS-CoV-2 2P S ectodomain bound domain-swapped antibody 2G12 from masked 3D refinement
Class: viral protein/immune system
Keywords: Fab-dimerized, glycan-reactive, antibodies, SARS, COVID19, VIRAL PROTEIN-IMMUNE SYSTEM complex SARS-CoV-2 2P S ectodomain, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2020-12-11, released 2020-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Spike glycoprotein
  Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
  Gene: S, 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0DTC2 (0-1120)
    • conflict (959-960)
• Chain 'B':
  Compound: Spike glycoprotein
  Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
  Gene: S, 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0DTC2 (0-1120)
    • conflict (959-960)
• Chain 'C':
  Compound: Spike glycoprotein
  Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
  Gene: S, 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0DTC2 (0-1120)
    • conflict (959-960)
• Chain 'H':
  Compound: 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 7L09 (0-225)
• Chain 'K':
  Compound: 2G12 Light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 7L09 (0-212)
  Domains in SCOPe 2.08: d7l09k1, d7l09k2
• Chain 'L':
  Compound: 2G12 Light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 7L09
  Domains in SCOPe 2.08: d7l09l1, d7l09l2
• Chain 'M':
  Compound: 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 7L09 (0-225)
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7l09K (K:)
  dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
  rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrge
  

  
  
• Chain 'L':
  Sequence, based on SEQRES records: (download)
  

  >7l09L (L:)
  dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
  rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrge
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7l09L (L:)
  vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
  fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
  deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
  skadyekhkvyacevthqglsspvtksfnrg
  

  
  
• Chain 'M':
  No sequence available.