PDB entry 7kpo

View 7kpo on RCSB PDB site
Description: high resolution crystal structure of the dna-binding domain from the sensor histidine kinase chis from vibrio cholerae
Deposited on 2020-11-12, released 2020-11-25
The last revision was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: GTF71_10845, GTF73_11165, GTF74_11165, GTF75_11330
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, PEG, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7kpoA (A:)
gsskqdlmravlveamtsalnywervsgqskftfaeqsglwrvyldrstlqtrtldkylr
ietlpktprwrtvlnsldyilehckeagperthiemqrdklqklltse

    Sequence, based on observed residues (ATOM records):
    >7kpoA (A:)
gsskqdlmravlveamtsalnywervsgqskftfaeqsglwrvyldrstlqtrtldkylr
ietlpktprwrtvlnsldyilehckeagperthiemqrdklqkllts