PDB entry 7kot

View 7kot on RCSB PDB site
Description: Energetic and structural effects of the Tanford transition on the ligand recognition of bovine Beta-lactoglobulin
Class: transport protein
Keywords: Bovine beta-lactoglobulin, Lipocalin, Tanford transition, Structural energetics, TRANSPORT PROTEIN
Deposited on 2020-11-09, released 2021-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7kota_
  • Heterogens: SDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7kotA (A:)
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

    Sequence, based on observed residues (ATOM records): (download) 
    >7kotA (A:)
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensqslacqclvrt
pevddealekfdkalkalpmhirlsfnptqleeqchi