PDB entry 7knd

View 7knd on RCSB PDB site
Description: C1B domain of Protein kinase C in apo form
Class: lipid binding protein
Keywords: C1, lipid-binding, diacylglycerol-binding, Zn2+ finger, LIPID BINDING PROTEIN
Deposited on 2020-11-04, released 2022-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-07-13, with a file datestamp of 2022-07-08.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c delta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkcd, rCG_42255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7knda_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7kndA (A:)
mphrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlcg

    Sequence, based on observed residues (ATOM records): (download) 
    >7kndA (A:)
mphrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc