PDB entry 7klr

View 7klr on RCSB PDB site
Description: Solution structure of the PHD1 domain of histone demethylase KDM5A in complex with a histone H3(1-10) peptide
Class: gene regulation
Keywords: PHD, H3, Epigenetics, KDM5A, GENE REGULATION
Deposited on 2020-10-31, released 2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 5A
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM5A, JARID1A, RBBP2, RBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29375 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.08: d7klra1, d7klra2
  • Chain 'B':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Gene: H3C1, H3FA, HIST1H3A, H3C2, H3FL, HIST1H3B, H3C3, H3FC HIST1H3C, H3C4, H3FB, HIST1H3D, H3C6, H3FD, HIST1H3E, H3C7, H3FI, HIST1H3F, H3C8, H3FH, HIST1H3G, H3C10, H3FK, HIST1H3H, H3C11, H3FF, HIST1H3I, H3C12, H3FJ, HIST1H3J
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7klrA (A:)
gsvnfvdlyvcmfcgrgnnedklllcdgcddsyhtfclipplpdvpkgdwrcpkcvaee

  • Chain 'B':
    No sequence available.