PDB entry 7kdz

View 7kdz on RCSB PDB site
Description: Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing Transcription Factor (BPTF) bound to TP-238
Class: gene regulation
Keywords: brd, phd, gene regulation, fac1, falz
Deposited on 2020-10-09, released 2020-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome-remodeling factor subunit BPTF
    Species: Homo sapiens [TaxId:9606]
    Gene: BPTF, FAC1, FALZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7kdza_
  • Heterogens: WCS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7kdzA (A:)
smstedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdl
atmeervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkas
rsh

    Sequence, based on observed residues (ATOM records): (download) 
    >7kdzA (A:)
pltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatmeervqrryy
ekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgf