PDB entry 7kdr

View 7kdr on RCSB PDB site
Description: Crystal structure of Escherichia coli HPPK in complex with bisubstrate inhibitor HP-75
Class: transferase/inhibitor
Keywords: alpha beta, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2020-10-09, released 2020-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: folK, b0142, JW0138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7kdra_
  • Heterogens: J1L, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7kdrA (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw