PDB entry 7k95

View 7k95 on RCSB PDB site
Description: crystal structure of human cpsf30 in complex with hfip1
Deposited on 2020-09-28, released 2020-11-11
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoform 2 of Cleavage and polyadenylation specificity factor subunit 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF4, CPSF30, NAR, NEB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Pre-mRNA 3'-end-processing factor FIP1
    Species: Homo sapiens [TaxId:9606]
    Gene: FIP1L1, FIP1, RHE
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Pre-mRNA 3'-end-processing factor FIP1
    Species: Homo sapiens [TaxId:9606]
    Gene: FIP1L1, FIP1, RHE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7k95A (A:)
hidpeskikdcpwydrgfckhgplcrhrhtrrvicvnylvgfcpegpsckfmhprfelpm

    Sequence, based on observed residues (ATOM records):
    >7k95A (A:)
ikdcpwydrgfckhgplcrhrhtrrvicvnylvgfcpegpsckfmhprfelpm

  • Chain 'B':
    Sequence, based on SEQRES records:
    >7k95B (B:)
sfedkpwrkpgadlsdyfnygfnedtwkaycekqkrirmgle

    Sequence, based on observed residues (ATOM records):
    >7k95B (B:)
dkpwrkpgadlsdyfnygfnedtwkaycekqkrirmgle

  • Chain 'C':
    Sequence, based on SEQRES records:
    >7k95C (C:)
sfedkpwrkpgadlsdyfnygfnedtwkaycekqkrirmgle

    Sequence, based on observed residues (ATOM records):
    >7k95C (C:)
edkpwrkpgadlsdyfnygfnedtwkaycek